PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009619370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family G2-like
Protein Properties Length: 400aa    MW: 44061.7 Da    PI: 7.2614
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009619370.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.82.1e-32224279156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+peLH+rF++a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  XP_009619370.1 224 KQRRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 279
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.865221281IPR017930Myb domain
SuperFamilySSF466891.09E-18222282IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.0E-29222282IPR009057Homeodomain-like
TIGRFAMsTIGR015577.1E-28224279IPR006447Myb domain, plants
PfamPF002498.0E-8226277IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MMINNHENNY TEKMQRCQQY IDALEEERNK IQVFSRELPL CLELVTQAID TYKQQLSGTT  60
TEYNLNAQSD VECSEEHTSS DVPILEEFIP LKRTFSHENE EEDEDERESH KSKTYNISDT  120
SCSKDNKNSD KSCKKSDWLR SVQLWNNNPT PDPTPKEELK PKKVAVVEVK KNGSGGAFHP  180
FKKEKSAPAA IEPPTSAVVS AAAASSTAET GSGSKKEEKD EKRKQRRCWS PELHRRFLQA  240
LQQLGGSHVA TPKQIRELMK VDGLTNDEVK SHLQKYRLHT RRPSPSSIHN NNQQPPQFVV  300
VGGIWVPPPE YAAMAAAAPS ASGEASGVAN SNGIYAPIAT LPKGPIHDVS GGTLKQRQHN  360
NKPSRSSEHG SGSHSDGGGV HSNSPTTSSS THTTTASPAY
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754442e-51HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009619370.10.0PREDICTED: two-component response regulator-like APRR2
TrEMBLK4BXE61e-179K4BXE6_SOLLC; Uncharacterized protein
STRINGSolyc05g009720.2.11e-179(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.18e-74G2-like family protein